Protein Info for BWI76_RS16505 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 42 to 64 (23 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 97 to 122 (26 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details amino acids 158 to 180 (23 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 268 to 287 (20 residues), see Phobius details amino acids 293 to 311 (19 residues), see Phobius details amino acids 331 to 349 (19 residues), see Phobius details amino acids 355 to 376 (22 residues), see Phobius details PF07690: MFS_1" amino acids 10 to 341 (332 residues), 130.6 bits, see alignment E=1e-41 PF06779: MFS_4" amino acids 15 to 373 (359 residues), 35.3 bits, see alignment E=1.3e-12 PF00083: Sugar_tr" amino acids 42 to 178 (137 residues), 28.7 bits, see alignment E=1e-10

Best Hits

Swiss-Prot: 89% identical to YDHP_ECOLI: Inner membrane transport protein YdhP (ydhP) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 95% identity to eae:EAE_17790)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4N7 at UniProt or InterPro

Protein Sequence (388 amino acids)

>BWI76_RS16505 MFS transporter (Klebsiella michiganensis M5al)
MKINFPLLALAIGAFGIGTTEFSPMGLLPVIAKGVDVSIPAAGMLISAYAIGVMVGAPLM
TLLLSHRARRNALIFLMAIFTLGNVLSSIAPDYTTLLLSRIITSLNHGAFFGLGSVVAAS
VVPKHKQASAVATMFMGLTIANIGGVPAATWLGETIGWRMSFLATAGLGVVAIIGLWFSL
PKGSAGERPNVKQELSVLMRPQVLSALLTTVLGAGAMFTLYTYISPVLHTITNASPLFVT
AMLVLIGVGFSLGNYLGGKFADRSVSGTLKGFLLLLMVIMLAIPLLAQSQVGAAISMVVW
GAATFAVVPPLQMRVMRVAHEAPGLSSSVNIGAFNLGNALGAAAGGAVISGGLGYAFVPV
MGAIIAGVALLLVLFSARGQPEEAFANR