Protein Info for BWI76_RS16495 in Klebsiella michiganensis M5al

Annotation: endopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF00877: NLPC_P60" amino acids 166 to 276 (111 residues), 116.5 bits, see alignment E=2.7e-38

Best Hits

KEGG orthology group: None (inferred from 82% identity to eae:EAE_17805)

Predicted SEED Role

"FIG00545237: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4N9 at UniProt or InterPro

Protein Sequence (284 amino acids)

>BWI76_RS16495 endopeptidase (Klebsiella michiganensis M5al)
MARLNKIAISLCALLFTSISLTPLAHASGHTHASATPKAHPAKGTTAERKKKAVNSKSKT
TAKTPSKKTSTASRSKSTASRQTASVTKKCVLRKGYKKLCASSTRSIAESKMATASVQKK
CVVRKGYKTRCKPIADEPQLTIADAHKARVQKAQSTAMSKLMDQIGKPYRWGGTSPRTGF
DCSGLVYYAYKDLVKIHIPRTANEMYHLRDARPVDRGELQSGDLVFFRTRGRGTADHVGV
YVGNGKFIQSPRTGRDIQITSLSDDYWVRHYVGARRVMTPKTIR