Protein Info for BWI76_RS16475 in Klebsiella michiganensis M5al

Annotation: alkene reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00724: Oxidored_FMN
  • amino acids 5 to 343 (339 residues), 287.6 bits, E=7.8e-90

Best Hits

Swiss-Prot: 87% identical to NEMA_ECOLI: N-ethylmaleimide reductase (nemA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 95% identity to eae:EAE_17825)

MetaCyc: 87% identical to N-ethylmaleimide reductase (Escherichia coli K-12 substr. MG1655)
1.3.1.-

Predicted SEED Role

"N-ethylmaleimide reductase (EC 1.-.-.-)" (EC 1.-.-.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

See A0A285B4W4 at UniProt or InterPro

Protein Sequence (365 amino acids)

>BWI76_RS16475 alkene reductase (Klebsiella michiganensis M5al)
MSESKLFTPLKVGAVTAPNRVFMAPLTRLRSIEPGDIPTPLMGEYYRQRASSGLIISEAT
QISAQAKGYAGAPGLHSPEQIAAWKKITAGVHAENGRIAVQLWHTGRISHSSIQPGGAAP
VAPSAISAGTRTSLRDENGHAIRVDTSMPRALNTDEIPGIVDDFRQAVGNARDAGFDLVE
LHSAHGYLLHQFLSPSSNHRTDQYGGSVENRARLVLEVVDAASKEWSADRIGIRVSPIGS
FQNVDNGANEEADALYLIEELAKRGIAYLHMSEPDWAGGQPYSDEFRQKVRDRFPGAIIG
AGAYTVEKANDLIGKGLIDAVAFGRDYIANPDLVARLQKKAALNPQRPESFYGGGAEGYT
DYPTL