Protein Info for BWI76_RS16430 in Klebsiella michiganensis M5al

Annotation: GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 42 to 63 (22 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 222 to 244 (23 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details PF17158: MASE4" amino acids 41 to 277 (237 residues), 246.5 bits, see alignment E=2.4e-77 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 290 to 447 (158 residues), 158.7 bits, see alignment E=5.3e-51 PF00990: GGDEF" amino acids 292 to 444 (153 residues), 157.8 bits, see alignment E=2.1e-50

Best Hits

KEGG orthology group: None (inferred from 70% identity to kva:Kvar_2323)

Predicted SEED Role

"FIG00731518: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B500 at UniProt or InterPro

Protein Sequence (450 amino acids)

>BWI76_RS16430 GGDEF domain-containing protein (Klebsiella michiganensis M5al)
MRANIKSLPQRIFLYAAVCILAITTLNYLSDSLIDRIPTTSSMLFPVLTISLMTFHIMIA
CFMGMKYLCDKKRLYLVPITFAFACSAMLMLGTIGSYPDWLICGQGRAINQNDALIFYFF
RNVMMAILFITSIVLYRFRNITLSSGKIHRTVLTGCFVFIAAVLILSWIHSSNSPLLSIE
FLDNLTYTFTPLWHNRIGWLLIIIWSVTLILLISLTQLRNIFWYSGAFFCTAYIFTLMVL
LSTAGDSSHAWNQARFFETLSTLFLILVLLCDVFMLYRESNERYVRSYQNSIRDPLTRLY
NRSYFYDTLNQRLPKVSASQPLSVIVCDLDRFKRINDTYGHVQGDKVIQFAASVLQNNVR
QDDAAARIGGEEFALLLVNIGAKEALAVAERIRLSVSEKQEGLPERMTISMGVFTTQDTR
VSAEECVKRADTAMYEAKNSGRNRVVVWHE