Protein Info for BWI76_RS16420 in Klebsiella michiganensis M5al

Annotation: anhydro-N-acetylmuramic acid kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF03702: AnmK" amino acids 5 to 367 (363 residues), 574 bits, see alignment E=7e-177

Best Hits

Swiss-Prot: 91% identical to ANMK_KLEP7: Anhydro-N-acetylmuramic acid kinase (anmK) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 91% identity to eae:EAE_17880)

MetaCyc: 84% identical to anhydro-N-acetylmuramic acid kinase (Escherichia coli K-12 substr. MG1655)
RXN0-4621 [EC: 2.7.1.170]

Predicted SEED Role

"Anhydro-N-acetylmuramic acid kinase (EC 2.7.1.-)" (EC 2.7.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-

Use Curated BLAST to search for 2.7.1.- or 2.7.1.170

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B536 at UniProt or InterPro

Protein Sequence (374 amino acids)

>BWI76_RS16420 anhydro-N-acetylmuramic acid kinase (Klebsiella michiganensis M5al)
MKSGRFIGVMSGTSLDGVDVVLAAINENMVAQQASLTYPIPIAIKEDILAICQGQQLTLS
QLGRLDTRLGRLFADAVQALMTQEKLQAADIIAIGCHGQTVWHEPTGDAPHTLQIGDNNQ
IAARTGVTVVGDFRRRDMALGGQGAPLVPAFHHALLAHPVERRMVLNIGGIANLSLLAPG
VPVRGYDTGPGNMLMDAWIWRQCGKPYDKDAQWASEGKVVLPLLQDMLSDPWFALPAPKS
TGREYFNYGWLSQHLARYPGLRAQDVQTTLAELTAVSISEQVLLSGGCERLLVCGGGARN
PLLMARLAALLPGTEVSTTDEAGISGDDMEALAFAWLAWRTLAGLPGNLPSVTGASQASV
LGAIFPANPPQNQS