Protein Info for BWI76_RS16400 in Klebsiella michiganensis M5al

Annotation: pyridoxal kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00687: pyridoxal kinase
  • amino acids 1 to 285 (285 residues), 456.3 bits, E=2.1e-141
• PF08543: Phos_pyr_kin
  • amino acids 73 to 259 (187 residues), 59.1 bits, E=4.4e-20
• PF00294: PfkB
  • amino acids 133 to 248 (116 residues), 41.8 bits, E=8.7e-15

Best Hits

Swiss-Prot: 91% identical to PDXY_SALPA: Pyridoxal kinase PdxY (pdxY) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: K00868, pyridoxine kinase [EC: 2.7.1.35] (inferred from 94% identity to kva:Kvar_2329)

MetaCyc: 90% identical to pyridoxal kinase 2 (Escherichia coli K-12 substr. MG1655)
Pyridoxal kinase. [EC: 2.7.1.35]

Predicted SEED Role

"Pyridoxal kinase (EC 2.7.1.35)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 2.7.1.35)

MetaCyc Pathways

• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (12/12 steps found)
• pyridoxal 5'-phosphate salvage I (6/6 steps found)
• pyridoxal 5'-phosphate salvage II (plants) (8/9 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (5/8 steps found)

KEGG Metabolic Maps

• Vitamin B6 metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.35

Use Curated BLAST to search for 2.7.1.35

Sequence Analysis Tools

See A0A285B4W6 at UniProt or InterPro

Protein Sequence (286 amino acids)

>BWI76_RS16400 pyridoxal kinase (Klebsiella michiganensis M5al)
MKNILAIQSHVVFGHAGNSAAEFPMRRLGANVWPLNTVQFSNHTQYGKWTGCVMPPAHLT
EIVQGIADINQLQRCDAVLSGYLGSAEQGEHILGIVRQVKSANPAAKYFCDPVMGHPEKG
CIVAPGVAEFHVRYALPASDIIAPNLVELEILCGHPVANVNEAVLAARELIAQGPEVVLV
KHLSRAGLSMDRFEMLLVTGQEAWHISRPLVDFGMRQPVGVGDVTSGLLLVKLLQGASLR
DALEHVTAAVYEIMLATKNMQEYELQVVAAQDRIAQPEHYFSATQL