Protein Info for BWI76_RS16380 in Klebsiella michiganensis M5al

Annotation: electron transport complex subunit RsxE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 transmembrane" amino acids 22 to 33 (12 residues), see Phobius details amino acids 35 to 56 (22 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 125 to 147 (23 residues), see Phobius details amino acids 183 to 206 (24 residues), see Phobius details PF02508: Rnf-Nqr" amino acids 6 to 199 (194 residues), 210.6 bits, see alignment E=8.9e-67 TIGR01948: electron transport complex, RnfABCDGE type, E subunit" amino acids 7 to 208 (202 residues), 272.2 bits, see alignment E=1.1e-85

Best Hits

Swiss-Prot: 97% identical to RNFE_KLEP3: Ion-translocating oxidoreductase complex subunit E (rnfE) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K03613, electron transport complex protein RnfE (inferred from 96% identity to kpn:KPN_01969)

Predicted SEED Role

"Electron transport complex protein RnfE" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4M0 at UniProt or InterPro

Protein Sequence (232 amino acids)

>BWI76_RS16380 electron transport complex subunit RsxE (Klebsiella michiganensis M5al)
MSEVKDVIVQGLWKNNSALVQLLGMCPLLAVTSTATNALGLGLATTLVLTLTNLTISSLR
RWTPAEIRIPIYVMIIASVVSVVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA
KKGPALSALDGFSIGMGATCAMFVLGSMREILGNGTLFDGADSLLGGWAKVLRIEVFHTD
TPFLLAMLPPGAFIGLGMMLAVKYLIDERSKQRKAKAAQADLIAPSDVTGKA