Protein Info for BWI76_RS16370 in Klebsiella michiganensis M5al

Annotation: electron transport complex subunit D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details amino acids 218 to 236 (19 residues), see Phobius details amino acids 243 to 262 (20 residues), see Phobius details amino acids 269 to 288 (20 residues), see Phobius details amino acids 300 to 318 (19 residues), see Phobius details amino acids 324 to 342 (19 residues), see Phobius details PF03116: NQR2_RnfD_RnfE" amino acids 5 to 348 (344 residues), 370.3 bits, see alignment E=3.9e-115 TIGR01946: electron transport complex, RnfABCDGE type, D subunit" amino acids 8 to 349 (342 residues), 485.7 bits, see alignment E=3.8e-150

Best Hits

Swiss-Prot: 91% identical to RNFD_KLEP3: Ion-translocating oxidoreductase complex subunit D (rnfD) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 93% identity to eae:EAE_17935)

Predicted SEED Role

"Electron transport complex protein RnfD" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4V8 at UniProt or InterPro

Protein Sequence (350 amino acids)

>BWI76_RS16370 electron transport complex subunit D (Klebsiella michiganensis M5al)
MVFRIASSPYTHNQRQTSRIMLLVLLAAVPGIVVQTWFFGWGTVLQIILAALTAWGAEAA
ILRLRKQNIPAILADNSALLTGLLLAVSIPPFAPWWMVVLGTAFAVIIAKQLYGGLGHNP
FNPAMIGYVVLLISFPVQMTSWLPPHEIAAHVPGFSDALRMIFTGHTATGGDMNSLRIGI
DGISQATPLDTFKTSLHAGHPVGEILQYPIYGGELAGLGWQWVNVAWLAGGLFLLWQKAI
RWHIPLSFLLSLAVCATLGWLFSPESLASPQMHLLSGATMLGAFFILTDPVTASTTNRGR
LIFGALAGLLVWLIRSFGGYPDGVAFAVLLANITVPLIDYYTRPRAYGHR