Protein Info for BWI76_RS16365 in Klebsiella michiganensis M5al

Annotation: electron transport complex subunit RsxC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 686 TIGR01945: electron transport complex, RnfABCDGE type, C subunit" amino acids 13 to 445 (433 residues), 592.7 bits, see alignment E=1.7e-182 PF13375: RnfC_N" amino acids 14 to 115 (102 residues), 104.4 bits, see alignment E=1.4e-33 PF01512: Complex1_51K" amino acids 139 to 283 (145 residues), 158.6 bits, see alignment E=5.7e-50 PF10531: SLBB" amino acids 296 to 344 (49 residues), 37.2 bits, see alignment 1.1e-12 PF13237: Fer4_10" amino acids 373 to 427 (55 residues), 36 bits, see alignment 2.9e-12 PF12838: Fer4_7" amino acids 377 to 430 (54 residues), 37.3 bits, see alignment 1.5e-12 PF13534: Fer4_17" amino acids 377 to 431 (55 residues), 23.6 bits, see alignment 3e-08 PF00037: Fer4" amino acids 413 to 430 (18 residues), 21.8 bits, see alignment (E = 6.2e-08)

Best Hits

Swiss-Prot: 84% identical to RNFC_KLEP3: Ion-translocating oxidoreductase complex subunit C (rnfC) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 84% identity to eae:EAE_17940)

Predicted SEED Role

"Electron transport complex protein RnfC" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (686 amino acids)

>BWI76_RS16365 electron transport complex subunit RsxC (Klebsiella michiganensis M5al)
MFKLFSAFRKDKVWDFNGGIHPPEMKIQSNGTPLRQVSLPQRFVIPLKQHIGAEGELCVQ
PGDRVLRGQPLTRGWGRMLPVHAPTSGIVAAIAPHSTAHPSALAEMSVIIDADGEDRWIE
RDGWYDYQNKSREALIERIHQFGVAGLGGAGFPTGAKLRGGGDKIDTLIINAAECEPYIT
ADDRLMQDCAAQIVEGIRILAHILQPGQVLIGIEDNKPQAISMLRAVLADTHGISLRVIP
TKYPSGGAKQLTQILTGKQVPHGGRSSDIGVLMQNVGTAYAVKRAVIDGEPLTERVVTLT
GEAVSRPGNVWARLGTPVSHLLKDAGFCPSADPMVIMGGPLMGFTLPWLDVPVVKITNCL
LAPSASEMGEPEEEKGCIRCSACADACPADLLPQQLYWFSKGQQHDKATSHNLADCIECG
ACAWVCPSNIPLVQYFRQEKAEISAIAQEEKRAAEAKIRFEARQARLERDKAARLERHKQ
AAVQPAAKDQDAINAALARVREKQRDAAQPIIVLSGVKPDNSEAIAAREARKAEARARKA
EQQTAPAVDAAADPRKAAVEAAIARAKARKAEQQTAPAVDAAAGQPAAADPRKAAVEAAI
ARAKARKAEQQTAPAVDAAAEQPAAADPRRAAVEAAIARAKARKAEQQQQAVPPSAANDD
ARKAAVAEAIARVQARKASRQAVNED