Protein Info for BWI76_RS16295 in Klebsiella michiganensis M5al

Annotation: bifunctional PTS system maltose and glucose-specific transporter subunits IICB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 530 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 62 to 88 (27 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 138 to 161 (24 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details amino acids 295 to 312 (18 residues), see Phobius details amino acids 322 to 338 (17 residues), see Phobius details amino acids 343 to 377 (35 residues), see Phobius details amino acids 379 to 391 (13 residues), see Phobius details amino acids 397 to 419 (23 residues), see Phobius details TIGR02004: PTS system, maltose and glucose-specific IIBC component" amino acids 8 to 525 (518 residues), 851.3 bits, see alignment E=3.6e-260 PF02378: PTS_EIIC" amino acids 19 to 361 (343 residues), 283.4 bits, see alignment E=2.3e-88 TIGR00852: PTS system, maltose and glucose-specific subfamily, IIC component" amino acids 70 to 372 (303 residues), 312.3 bits, see alignment E=4.7e-97 TIGR00826: PTS system, glucose-like IIB component" amino acids 420 to 511 (92 residues), 86.1 bits, see alignment E=2.3e-28 PF00367: PTS_EIIB" amino acids 454 to 486 (33 residues), 60 bits, see alignment (E = 1.1e-20)

Best Hits

Swiss-Prot: 89% identical to PTOCB_ECOLI: PTS system maltose-specific EIICB component (malX) from Escherichia coli (strain K12)

KEGG orthology group: K02790, PTS system, maltose and glucose-specific IIB component [EC: 2.7.1.69] K02791, PTS system, maltose and glucose-specific IIC component (inferred from 94% identity to kpu:KP1_2520)

MetaCyc: 89% identical to PTS enzyme IIBC component MalX (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-574; TRANS-RXN0-575

Predicted SEED Role

"PTS system, maltose and glucose-specific IIC component (EC 2.7.1.69) / PTS system, maltose and glucose-specific IIB component (EC 2.7.1.69)" in subsystem Maltose and Maltodextrin Utilization (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4M3 at UniProt or InterPro

Protein Sequence (530 amino acids)

>BWI76_RS16295 bifunctional PTS system maltose and glucose-specific transporter subunits IICB (Klebsiella michiganensis M5al)
MTAKTASKITLWEFFQQLGKTFMLPVALLSFCGIMLGIGSSLSSHDVLTLLPWLDVPLLQ
AVFIWMGKVGSFAFSFLPVMFCIAIPLGLARENKGVAAFAGFVGYAVMNLAVNFWLTAKG
ILPTTDAAVLKANNIQNIIGIQSIDTGILGAVIAGIIVWMLHERFHNIRLPDALAFFGGT
RFVPIITTVVLGLVGLVIPLIWPVFAMGINALGQVINSAGDFGPMIFGTGERLLLPFGLH
HILVALIRFTEAGGTMDVCGHSVSGALTIFQAQLSCPTTHGFSESATRFLSQGKMPAFLG
GLPGAALAMYHCARPENRHKIKGLLISGVIACVVGGTTEPLEFLFLFVAPVLYVIHALLT
GLGFTMMAILGVTIGNTDGNVIDFVVFGILHGLSTKWYLVPVVAAIWFAVYYGIFRFAIT
RFNLKTPGRDIETNSAFEKAVTGVTGKSGYNVPAILAALGGAENIVSLDNCITRLRLSVN
DMSKVDSAALKANRAIGVVQLNQHNLQVVIGPQVQSVKDEMAVLMNTVEA