Protein Info for BWI76_RS16265 in Klebsiella michiganensis M5al

Annotation: DNA replication terminus site-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 PF05472: Ter" amino acids 9 to 306 (298 residues), 431.4 bits, see alignment E=7.4e-134 TIGR02648: DNA replication terminus site-binding protein" amino acids 10 to 307 (298 residues), 480.9 bits, see alignment E=7.7e-149

Best Hits

Swiss-Prot: 86% identical to TUS_KLEP3: DNA replication terminus site-binding protein (tus) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 88% identity to eae:EAE_18065)

Predicted SEED Role

"DNA replication terminus site-binding protein" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4P3 at UniProt or InterPro

Protein Sequence (310 amino acids)

>BWI76_RS16265 DNA replication terminus site-binding protein (Klebsiella michiganensis M5al)
MASYDLVERLNGTFRQLERELQELKQSLSQCRLLAARVFELPPVSKDAEHQPLDSINVVQ
HTGKTALEMALRHYSHLFIQQQSETRSSKAAVRLPGAICLQTDANQQAELAGKIAHINAL
KATFEKIITVDSGLPAAARFEWVHRHLPGLITLSAYRTLTPLLDPSTIRFGWANKHVIKN
LTRDRVLMQLEKSLQSPRAVPPWTREQWQSKLEREYQDIAALPQRAKLKIKRPVKVQPIA
RVWYSGEQKQVQYACPGPMIALISGTKGVSVPDLGELLNYDAENVQYRYKPQAQSLRLLI
PRLHLWLANE