Protein Info for BWI76_RS16225 in Klebsiella michiganensis M5al

Annotation: arginine:ornithine antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 41 to 61 (21 residues), see Phobius details amino acids 82 to 110 (29 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 203 to 222 (20 residues), see Phobius details amino acids 234 to 256 (23 residues), see Phobius details amino acids 283 to 311 (29 residues), see Phobius details amino acids 333 to 351 (19 residues), see Phobius details amino acids 357 to 378 (22 residues), see Phobius details amino acids 385 to 402 (18 residues), see Phobius details amino acids 408 to 426 (19 residues), see Phobius details amino acids 440 to 459 (20 residues), see Phobius details TIGR00905: transporter, basic amino acid/polyamine antiporter (APA) family" amino acids 3 to 459 (457 residues), 587 bits, see alignment E=1.5e-180 PF13520: AA_permease_2" amino acids 5 to 416 (412 residues), 263.9 bits, see alignment E=4.1e-82 PF03845: Spore_permease" amino acids 8 to 256 (249 residues), 28.1 bits, see alignment E=1.4e-10 PF00324: AA_permease" amino acids 14 to 376 (363 residues), 53.6 bits, see alignment E=2.3e-18

Best Hits

Swiss-Prot: 88% identical to ARCD_SHIFL: Putative arginine/ornithine antiporter (ydgI) from Shigella flexneri

KEGG orthology group: K03758, arginine:ornithine antiporter (inferred from 93% identity to kpu:KP1_2534)

Predicted SEED Role

"Arginine/ornithine antiporter ArcD" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4Z5 at UniProt or InterPro

Protein Sequence (460 amino acids)

>BWI76_RS16225 arginine:ornithine antiporter (Klebsiella michiganensis M5al)
MEKKLGLSALTALVLSSMLGAGVFSLPQNMAAVASPSALLIGWGITGVGILFLAFAMLLL
TRIRPDLDGGIFTYAREGFGELIGFCSAWGYWLCAVVANVSYLVIVFSALSFFTDTPELR
LFGDGNTWQSIIGASVLLWIVHFLVLRGVQTAAGINLAATLAKLLPLGAFIALAAMAFRM
ETFRLDFSGLALGVPVWEQVKNTMLITLWVFIGVEGAVVVSARARNKQDVGRATLLAVLS
ALAVYLLVTLLSLGVVPRSELAEIRNPSMAGLMVNMMGSWGEIVIAAGLIISVCGAYLSW
TIMAAEVPYLAATHKAFPRLFARTNKNNAPSSSLWLTNISVQASLVLIWLTGSDYSTLLT
IASEMILVPYFLVGAFLLKIARRPLHKAVGVGACIYGLWLLYASGPVHLLLSVILYAPGL
LVFLYARRTHQHDRPLKRRDLALIGFLLVAAVPATWMLVG