Protein Info for BWI76_RS16200 in Klebsiella michiganensis M5al

Annotation: NAD(P) transhydrogenase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 34 to 51 (18 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 163 to 179 (17 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 215 to 234 (20 residues), see Phobius details amino acids 240 to 260 (21 residues), see Phobius details PF02233: PNTB" amino acids 7 to 460 (454 residues), 679.6 bits, see alignment E=1.2e-208

Best Hits

Swiss-Prot: 92% identical to PNTB_ECO57: NAD(P) transhydrogenase subunit beta (pntB) from Escherichia coli O157:H7

KEGG orthology group: K00325, NAD(P) transhydrogenase subunit beta [EC: 1.6.1.2] (inferred from 94% identity to kpn:KPN_01527)

MetaCyc: 92% identical to pyridine nucleotide transhydrogenase subunit beta (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-277 [EC: 7.1.1.1]

Predicted SEED Role

"NAD(P) transhydrogenase subunit beta (EC 1.6.1.2)" in subsystem Phosphate metabolism (EC 1.6.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.1.2

Use Curated BLAST to search for 1.6.1.2 or 7.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4N1 at UniProt or InterPro

Protein Sequence (462 amino acids)

>BWI76_RS16200 NAD(P) transhydrogenase subunit beta (Klebsiella michiganensis M5al)
MSGGLVTAAYIVAAILFIFSLAGLSKHETSQQGNYYGIAGMAIALVATILGPDSSNVAWI
LLAMVIGGAIGIRLAKKVEMTEMPELVAILHSFVGLAAVLVGFNSYLQHETGMEQILVNI
HLTEVFLGIFIGAVTFTGSVVAFGKLCGKMSSKPLMLPNRHKLNLAALVVSFLLLIVFVR
TDSIGMQVLCLLVMTVIALAFGWHLVASIGGADMPVVVSMLNSYSGWAAAAAGFMLSNDL
LIVTGALVGSSGAILSYIMCKAMNRSFFSVIAGGFGSDGTASTADEEVGEHREISAEETA
EMLKGSQSVIITPGYGMAVAQAQYPVAEITERLRARGIKVRFGIHPVAGRLPGHMNVLLA
EAKVPYDIVLEMDEINDDFSDTDTVLVIGANDTVNPAAQDDPGSPIAGMPVLEVWKAQNV
IVFKRSMNTGYAGVQNPLFFKENTHMLFGDAKASVDAILKAL