Protein Info for BWI76_RS16185 in Klebsiella michiganensis M5al

Annotation: transcriptional regulator FNR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 PF00027: cNMP_binding" amino acids 51 to 132 (82 residues), 61.9 bits, see alignment E=6.9e-21 PF13545: HTH_Crp_2" amino acids 168 to 242 (75 residues), 59.3 bits, see alignment E=4.4e-20 PF00325: Crp" amino acids 193 to 224 (32 residues), 58.8 bits, see alignment 5.1e-20

Best Hits

Swiss-Prot: 100% identical to FNR_KLEOX: Fumarate nitrate reduction regulatory protein (fnr) from Klebsiella oxytoca

KEGG orthology group: K01420, CRP/FNR family transcriptional regulator, anaerobic regulatory protein (inferred from 98% identity to eco:b1334)

Predicted SEED Role

"Fumarate and nitrate reduction regulatory protein" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4K5 at UniProt or InterPro

Protein Sequence (250 amino acids)

>BWI76_RS16185 transcriptional regulator FNR (Klebsiella michiganensis M5al)
MIPEKRIIRRIQSGGCAIHCQDCSISQLCIPFTLNEHELDQLDNIIERKKPIQKGQTLFK
AGDELKSLYAIRSGTIKSYTITEQGDEQITGFHLAGDLVGFDAIGTGHHPSFAQALETSM
VCEIPFETLDDLSGKMPNLRQQMMRLMSGEIKGDQDMILLLSKKNAEERLAAFIYNLSRR
FAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSGMLAVKGKYITIENSDLLA
QLAGQARNVA