Protein Info for BWI76_RS16175 in Klebsiella michiganensis M5al

Annotation: p-aminobenzoyl-glutamate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 transmembrane" amino acids 30 to 53 (24 residues), see Phobius details amino acids 85 to 109 (25 residues), see Phobius details amino acids 124 to 159 (36 residues), see Phobius details amino acids 166 to 188 (23 residues), see Phobius details amino acids 214 to 232 (19 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details amino acids 301 to 322 (22 residues), see Phobius details amino acids 343 to 363 (21 residues), see Phobius details amino acids 383 to 403 (21 residues), see Phobius details amino acids 411 to 434 (24 residues), see Phobius details amino acids 440 to 458 (19 residues), see Phobius details amino acids 470 to 495 (26 residues), see Phobius details TIGR00819: AbgT transporter family" amino acids 1 to 507 (507 residues), 840.1 bits, see alignment E=3.1e-257 PF03806: ABG_transport" amino acids 14 to 505 (492 residues), 663.9 bits, see alignment E=6.2e-204

Best Hits

Swiss-Prot: 88% identical to ABGT_ECOLI: p-aminobenzoyl-glutamate transport protein (abgT) from Escherichia coli (strain K12)

KEGG orthology group: K12942, aminobenzoyl-glutamate transport protein (inferred from 95% identity to kva:Kvar_2825)

MetaCyc: 88% identical to p-aminobenzoyl glutamate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-452

Predicted SEED Role

"Aminobenzoyl-glutamate transport protein" in subsystem p-Aminobenzoyl-Glutamate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4I0 at UniProt or InterPro

Protein Sequence (508 amino acids)

>BWI76_RS16175 p-aminobenzoyl-glutamate transporter (Klebsiella michiganensis M5al)
MSMSSIPSPSPSGKLYGWVEKIGNKVPHPFLLFIYLIVALMVATAILSALNVGVQNPTDG
SRVVVKNLLSVEGLHWFLPNVIKNFSGFAPLGAILALVLGAGFAERVGLLPSLMVKMSSH
VSARYASYMVLFIAFFSHISSDAALVIMPPLGALMFLAVGRHPVAGLLAAIAGVGCGFTA
NLLIVTTDVLLSGISTEAAKTLDASLHVSVIDNWYFMATSVIVLTLVGGLITDKLVEPRL
GQWQGGSDETLQTLTAEQRFGLRVAGVAALLFVAVIALMVIPENGILRDPIKHTVMPSPF
IKGIVPLIIFFFFVVSLAYGIATGKIRRQADLPQLMIEPMKEMAGFIVMVFPLAQFVAMF
NWSNMGKFMAVGLTDLLESAGMNGVPAFVGLALLSAFLCMFIASGSAIWSILAPIFVPMF
MLLGFHPAFAQILFRIADSSVLPLAPVSPFVPLFLGFLQRYRPEAKLGTYYSLVLPYPLI
FLAVWLLLLVGWYLVGLPIGPGIYPRLP