Protein Info for BWI76_RS16135 in Klebsiella michiganensis M5al

Annotation: acetyl-CoA acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02430: 3-oxoadipyl-CoA thiolase
  • amino acids 3 to 400 (398 residues), 723.9 bits, E=5.2e-222
• PF00108: Thiolase_N
  • amino acids 5 to 268 (264 residues), 246.6 bits, E=4.2e-77
• TIGR01930: acetyl-CoA C-acyltransferase
  • amino acids 6 to 398 (393 residues), 446.1 bits, E=1e-137
• PF00109: ketoacyl-synt
  • amino acids 86 to 130 (45 residues), 25.6 bits, 1.3e-09
• PF02803: Thiolase_C
  • amino acids 276 to 399 (124 residues), 149.5 bits, E=5.5e-48

Best Hits

Swiss-Prot: 69% identical to CATF_ACIAD: Beta-ketoadipyl-CoA thiolase (catF) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: None (inferred from 94% identity to kpn:KPN_01540)

MetaCyc: 72% identical to 3-oxoadipyl-CoA thiolase (Cupriavidus necator H16)
3-oxoadipyl-CoA thiolase. [EC: 2.3.1.174]

Predicted SEED Role

"Acetyl-CoA acetyltransferase (EC 2.3.1.9) @ Beta-ketoadipyl CoA thiolase (EC 2.3.1.-)" (EC 2.3.1.-, EC 2.3.1.9)

MetaCyc Pathways

• oleate β-oxidation (32/35 steps found)
• superpathway of phenylethylamine degradation (11/11 steps found)
• aromatic compounds degradation via β-ketoadipate (9/9 steps found)
• phenylacetate degradation I (aerobic) (9/9 steps found)
• superpathway of salicylate degradation (7/7 steps found)
• catechol degradation III (ortho-cleavage pathway) (6/6 steps found)
• adipate degradation (5/5 steps found)
• mandelate degradation to acetyl-CoA (14/18 steps found)
• 3-oxoadipate degradation (2/2 steps found)
• acetoacetate degradation (to acetyl CoA) (2/2 steps found)
• glycerol degradation to butanol (12/16 steps found)
• (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (4/5 steps found)
• adipate biosynthesis (4/5 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• pyruvate fermentation to hexanol (engineered) (8/11 steps found)
• 4-methylcatechol degradation (ortho cleavage) (5/7 steps found)
• acetyl-CoA fermentation to butanoate (5/7 steps found)
• polyhydroxybutanoate biosynthesis (2/3 steps found)
• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (6/9 steps found)
• glutaryl-CoA degradation (3/5 steps found)
• pyruvate fermentation to acetone (3/5 steps found)
• (2S)-ethylmalonyl-CoA biosynthesis (2/4 steps found)
• toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
• pyruvate fermentation to butanoate (4/7 steps found)
• ketolysis (1/3 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (6/10 steps found)
• valproate β-oxidation (5/9 steps found)
• isopropanol biosynthesis (engineered) (2/5 steps found)
• L-glutamate degradation VII (to butanoate) (7/12 steps found)
• 2-deoxy-D-ribose degradation II (4/8 steps found)
• pyruvate fermentation to butanol I (4/8 steps found)
• benzoyl-CoA degradation I (aerobic) (3/7 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (23/35 steps found)
• superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (5/10 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (7/13 steps found)
• ketogenesis (1/5 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
• mevalonate pathway I (eukaryotes and bacteria) (2/7 steps found)
• mevalonate pathway II (haloarchaea) (2/7 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (9/17 steps found)
• 2-methylpropene degradation (2/8 steps found)
• isoprene biosynthesis II (engineered) (2/8 steps found)
• mevalonate pathway III (Thermoplasma) (2/8 steps found)
• mevalonate pathway IV (archaea) (2/8 steps found)
• L-lysine fermentation to acetate and butanoate (3/10 steps found)
• methyl tert-butyl ether degradation (2/10 steps found)
• 4-oxopentanoate degradation (1/9 steps found)
• ethylmalonyl-CoA pathway (2/11 steps found)
• superpathway of aerobic toluene degradation (15/30 steps found)
• L-tryptophan degradation III (eukaryotic) (4/15 steps found)
• crotonate fermentation (to acetate and cyclohexane carboxylate) (3/16 steps found)
• benzoate fermentation (to acetate and cyclohexane carboxylate) (3/17 steps found)
• toluene degradation VI (anaerobic) (3/18 steps found)
• superpathway of ergosterol biosynthesis I (4/26 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (23/56 steps found)
• superpathway of L-lysine degradation (12/43 steps found)
• superpathway of cholesterol biosynthesis (4/38 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Fatty acid metabolism
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Propanoate metabolism
• Pyruvate metabolism
• Synthesis and degradation of ketone bodies
• Terpenoid biosynthesis
• Tryptophan metabolism
• Tyrosine metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.174, 2.3.1.9

Use Curated BLAST to search for 2.3.1.- or 2.3.1.174 or 2.3.1.9

Sequence Analysis Tools

See A0A285B4T5 at UniProt or InterPro

Protein Sequence (400 amino acids)

>BWI76_RS16135 acetyl-CoA acetyltransferase (Klebsiella michiganensis M5al)
MNQAFICDAVRTPFGRFGGTLATLRADDLAALPLKALLERNPGLDPARIDDVIYGCANQA
GEDNRNVARMALLLAGLPESVPGSTVNRLCGSSLDAIGIAARAIKSGETQLMIAGGVESM
SRAPFVMGKAESAFSRTMRMEDTTIGWRFINPQMKALYGVDSMPETAENVADDFAISRAD
QDAFALRSQLRTAAAQEAGRFADELIAVSVPQRKGEPLLFSRDEHPRTTTAEALARLRGV
VRPDGTVTAGNASGVNDGACALLLASEQALAANDLQPLARVVGVATAGVAPRIMGFGPAP
AVRKVLAQTGLTLGQMDVIELNEAFAAQALAVTRDLGLPDDAAYVNPNGGAIALGHPLGA
SGGRLAMTAAYQLRRTGGRYALCTMCIGVGQGIALIIERV