Protein Info for BWI76_RS16130 in Klebsiella michiganensis M5al

Annotation: 3-carboxy-cis,cis-muconate cycloisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02426: 3-carboxy-cis,cis-muconate cycloisomerase
  • amino acids 6 to 345 (340 residues), 406.9 bits, E=3e-126
• PF00206: Lyase_1
  • amino acids 10 to 298 (289 residues), 183.8 bits, E=5.5e-58
• PF10397: ADSL_C
  • amino acids 362 to 439 (78 residues), 54.1 bits, E=1.6e-18

Best Hits

Swiss-Prot: 55% identical to PCAB_PSEAE: 3-carboxy-cis,cis-muconate cycloisomerase (pcaB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 83% identity to eae:EAE_18185)

MetaCyc: 52% identical to subunit of 3-carboxymuconate cycloisomerase (Pseudomonas putida)
3-carboxy-cis,cis-muconate cycloisomerase. [EC: 5.5.1.2]

Predicted SEED Role

"3-carboxy-cis,cis-muconate cycloisomerase (EC 5.5.1.2)" in subsystem Protocatechuate branch of beta-ketoadipate pathway (EC 5.5.1.2)

MetaCyc Pathways

• aromatic compounds degradation via β-ketoadipate (9/9 steps found)
• protocatechuate degradation II (ortho-cleavage pathway) (4/4 steps found)
• toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (23/35 steps found)
• superpathway of aerobic toluene degradation (15/30 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.5.1.2

Sequence Analysis Tools

See A0A285B4P2 at UniProt or InterPro

Protein Sequence (450 amino acids)

>BWI76_RS16130 3-carboxy-cis,cis-muconate cycloisomerase (Klebsiella michiganensis M5al)
MSLLTPMMRTSPLTAWFSDAQRVQGMLDFEAALARAQVECGLVPQAALTPILETCRHENI
DFAALGQAAASAGNLAIPLVKQLTARVRERDEAAARYLHWGATSQDAIDTGFILQLRGAL
AETESLLQRLLDALASQAQRYQDTVMPGRTWMQHALPVTFGLKLAGTLDALLRWQTRLRE
MRSRVLALQFGGAAGTLDSLKTQAPQVAIALAKTLDLQLPDTPWHSQRDRLLEVGAWYAG
VCGTLGKFANDFSLLMQSEVAEVAEPVAEGRGGSSTMPHKRNPIACAAILTAAQRTPGLV
ATLYTGQIQQHERALGGWQAEWETLPELMTLVGGALAQSEALVRDMQVFPPKMRADLEIT
HGLIMAEAVTLALAEFIGKADAHHRIEALCRQALDTSCSLQSVLENDPQVSEHLSADRLT
QLLDPTTATGSAALFVRQVVARYKEQLHEC