Protein Info for BWI76_RS16045 in Klebsiella michiganensis M5al

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 35 to 54 (20 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 181 to 198 (18 residues), see Phobius details amino acids 205 to 226 (22 residues), see Phobius details amino acids 234 to 258 (25 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details TIGR00946: auxin efflux carrier" amino acids 1 to 317 (317 residues), 253.1 bits, see alignment E=1.9e-79 PF03547: Mem_trans" amino acids 4 to 313 (310 residues), 263.2 bits, see alignment E=1.3e-82

Best Hits

KEGG orthology group: None (inferred from 97% identity to eae:EAE_18265)

Predicted SEED Role

"FIG00613710: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4H6 at UniProt or InterPro

Protein Sequence (319 amino acids)

>BWI76_RS16045 transporter (Klebsiella michiganensis M5al)
MTYVIIHALAPIFVIMLLGFWAGKAKMVDNKNVSLLNIFVMDFALPATLFSATVQTPWSG
IVAQSPLVLVLTGAMWITYAAIYFLATRVFKRSPQDAAVLTLTVALPNYAALGLPILGSV
LGEGASTSLSVAVSIACGSVLMTPFCLLILEREKALAAGENSGSTLAMLPVLMWRSVKKP
IVWGPLLGVVLSAIGIKMPDLLLAAIKPLGLAATAAALFLTGVILSARKLQLNTLIATST
VVKLLVQPFIAWGLVMLLGLHGSIAITAILMIALAAGFFGVVFGNRFGVQSPDAEAVLLL
SSVLCILSLPLFITLTSGI