Protein Info for BWI76_RS16040 in Klebsiella michiganensis M5al

Annotation: biotin-independent malonate decarboxylase subunit gamma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 TIGR03134: biotin-independent malonate decarboxylase, gamma subunit" amino acids 10 to 266 (257 residues), 319.5 bits, see alignment E=8.4e-100 PF06833: MdcE" amino acids 11 to 266 (256 residues), 323.8 bits, see alignment E=3.2e-101

Best Hits

KEGG orthology group: K13933, malonate decarboxylase gamma subunit (inferred from 89% identity to kva:Kvar_2799)

MetaCyc: 90% identical to malonate decarboxylase malonyl-[acp] decarboxylase component beta subunit (Klebsiella pneumoniae)
Biotin-independent malonate decarboxylase. [EC: 4.1.1.88]; Malonyl-S-ACP decarboxylase. [EC: 4.1.1.88, 4.1.1.87]

Predicted SEED Role

"Malonate decarboxylase gamma subunit" in subsystem Malonate decarboxylase

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.88

Use Curated BLAST to search for 4.1.1.87 or 4.1.1.88

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4R8 at UniProt or InterPro

Protein Sequence (266 amino acids)

>BWI76_RS16040 biotin-independent malonate decarboxylase subunit gamma (Klebsiella michiganensis M5al)
MSQFTHRAALWLNQLAPNAPLMTGLCPSVQVADADFNGETARFIAVVPDANNHYPRAANG
EVGLLEGWTLAKVVNETIDADADKTVKRPIIAVIDVPSQAYGRREEAFGIHQALASAAGA
YAKARLAGHPVIGLIVGKAMSGAFLAHGYQANRLIAFNDAGVLVHAMGKESAARITLRSV
EALEKLAATIPPMAYDVSNYATLGLLSALLDISNPDAPDARDLTLVTDTLRDAIADARRD
ASLKCRLGAANRRSSQQVRDRMRASW