Protein Info for BWI76_RS16015 in Klebsiella michiganensis M5al

Annotation: pheromone autoinducer 2 transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 33 to 55 (23 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 111 to 124 (14 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details amino acids 224 to 246 (23 residues), see Phobius details amino acids 252 to 275 (24 residues), see Phobius details amino acids 287 to 307 (21 residues), see Phobius details amino acids 313 to 313 (1 residues), see Phobius details amino acids 317 to 338 (22 residues), see Phobius details PF01594: AI-2E_transport" amino acids 14 to 328 (315 residues), 240.3 bits, see alignment E=1.6e-75

Best Hits

Swiss-Prot: 81% identical to TQSA_SHIFL: AI-2 transport protein TqsA (tqsA) from Shigella flexneri

KEGG orthology group: K11744, AI-2 transport protein TqsA (inferred from 94% identity to kva:Kvar_2794)

MetaCyc: 81% identical to autoinducer 2 exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-453

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4D2 at UniProt or InterPro

Protein Sequence (344 amino acids)

>BWI76_RS16015 pheromone autoinducer 2 transporter (Klebsiella michiganensis M5al)
MAKPIITLNGLKIVIMLGMLVIILTGIRFAADIIVPFVLAIFLAVVINPLVQLMVRCRVP
RVLAISLLVGVIVLLAVVLLASLGTSLNELARTLPQYRNYLYEPMQTVAPWLQRFGFTVS
VVELNKYIDPNAVMTLVTGLLTQLSNAMSSIFLLLLTVVFMLLEVPQLPAKLQQLMSRPV
EGMGAIQRALDSVSHYLVLKTAISLVTGLVVWGMLVLLDVRFAFMWGLLAFALNYIPNIG
SVLAAIPPILQVLVFGGLYEALVVLAGYLAINLVFGNILEPRIMGRGLGLSTLVVFLSLI
FWGWLLGPVGMLLSVPLTIIVKIALEQTVAGQSIAFLLSDLSKN