Protein Info for BWI76_RS16005 in Klebsiella michiganensis M5al
Annotation: multidrug transporter subunit MdtJ
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 86% identical to MDTJ_KLEP7: Spermidine export protein MdtJ (mdtJ) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
KEGG orthology group: None (inferred from 88% identity to eae:EAE_18305)MetaCyc: 80% identical to multidrug/spermidine efflux pump membrane subunit MdtJ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-350; TRANS-RXN0-266
Predicted SEED Role
"Spermidine export protein MdtJ"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285B4J6 at UniProt or InterPro
Protein Sequence (120 amino acids)
>BWI76_RS16005 multidrug transporter subunit MdtJ (Klebsiella michiganensis M5al) MFYWILLALAIVAEITGTLSMKWASVSGGHTGFILMLVMIALSYIFLAFAVKKIALGVAY ALWEGIGILLITIFSVLLFDETLSTIKIAGLVTLVAGIVLIKSGTQKTVKPGKEKTHATV