Protein Info for BWI76_RS15995 in Klebsiella michiganensis M5al

Annotation: bifunctional diguanylate cyclase/phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 718 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 265 to 287 (23 residues), see Phobius details PF05228: CHASE4" amino acids 61 to 216 (156 residues), 48.1 bits, see alignment E=2e-16 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 297 to 456 (160 residues), 121.4 bits, see alignment E=1.5e-39 PF00990: GGDEF" amino acids 299 to 453 (155 residues), 126.4 bits, see alignment E=1.4e-40 PF00563: EAL" amino acids 476 to 704 (229 residues), 231.1 bits, see alignment E=1.9e-72

Best Hits

KEGG orthology group: None (inferred from 78% identity to eae:EAE_18315)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4P1 at UniProt or InterPro

Protein Sequence (718 amino acids)

>BWI76_RS15995 bifunctional diguanylate cyclase/phosphodiesterase (Klebsiella michiganensis M5al)
MIHLPGWRNIPSARTLSIMIVLAGIGLIVSIISLLYLSQHLIGLKANEIDKHRSVLSVDG
AVQTSVNRVLSLVMDNAIWDDAVHQTYTDRLDPQWLYNSWGSGFKINNLYDGTFVLDQHY
RVLWGSFRSESFTEQDTQFLGNGFHSLISQHAAALRSGKSAYAGITRTRAGIAFIAIGLI
RPTTGRLQVYDDTRRYLVITRHINPQMLERLGDTFQIRNLHVTPGGGEYSIPLRTQSGEI
VGYLSWQPGLPGAEAARAASNNIRLIAVVAAGLILLFILFSCLGLYKLARGEKLARNIAM
TDWLSRLPNRRALIERLNQVCENAQYQTQSVVFIDLDGFKDVNDNYGHDVGDALIIHIAK
ELRQRVPPEGMLARMGGDEFAMTVSGEQAVNQALAFAWAVLELLKAPVILNERKIYISAS
IGIASGVPASCSSTELFRRADIAMYHSKKTGKGRTTWYDEALSDARQYQLNIENGIRQGL
ENEEFDVWYQPIVNADTLVMEGVEALLRWPRRPQGALPPDTFIGIAESSGLIYALGQFVL
QRACSELQPLDDLLLSVNISPAQFRDPEFESRVVQVLGRCHFPARRLQLEVTESYVLENP
ERARAAIENLRSLGIAVALDDFGTGYSSIGYLRSFSFDSLKIDKSLAGLVDVDTQAAELV
RGTVRIAGALGITVVAEGVENQQQLALLRRAGCDKLQGFFFSEPMPVASLLQLRQQQG