Protein Info for BWI76_RS15940 in Klebsiella michiganensis M5al

Annotation: DMSO reductase maturation protein DsmD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 PF02613: Nitrate_red_del" amino acids 55 to 161 (107 residues), 80.5 bits, see alignment E=6.3e-27

Best Hits

Swiss-Prot: 63% identical to DMSD_SALTY: Tat proofreading chaperone DmsD (dmsD) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 78% identity to eae:EAE_18370)

Predicted SEED Role

"Anaerobic dimethyl sulfoxide reductase chaperone DmsD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4K2 at UniProt or InterPro

Protein Sequence (202 amino acids)

>BWI76_RS15940 DMSO reductase maturation protein DsmD (Klebsiella michiganensis M5al)
MMQAQDRDAVALSARTLGALFSFAPDSEQVAPLIAALRDGSWQSQWPWPVADGLAAQFAI
ASDEPLAEAWQRLFIGPWALPAPPWGSVWLDKESVLFGDSTLALREWMRATGISLSERRA
EPEDHFGTLLLLAAWLCESAQDEAFNQLLAWHLLPWSGRFLSVFIAGAENPFYQALGQLA
QETLARWQAQLPCAVADKPLYR