Protein Info for BWI76_RS15905 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 113 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF06932: DUF1283" amino acids 32 to 113 (82 residues), 152.9 bits, see alignment E=1.1e-49

Best Hits

Swiss-Prot: 89% identical to Y1554_KLEP7: UPF0482 protein KPN78578_15540 (KPN78578_15540) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 92% identity to eae:EAE_18405)

Predicted SEED Role

"putative secreted protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4E9 at UniProt or InterPro

Protein Sequence (113 amino acids)

>BWI76_RS15905 hypothetical protein (Klebsiella michiganensis M5al)
MNTTLNKRWCLTALLALSAMVFTASSFAKTDKLVIESGDSAQSRQQAAMEKEQWNDTRSL
RQKVNTRAEKEWDKADVAFDAQDNCQKSANVNAYWEPNTLRCLDRRTGRTITP