Protein Info for BWI76_RS15495 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 transmembrane" amino acids 25 to 49 (25 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 127 to 152 (26 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 222 to 246 (25 residues), see Phobius details amino acids 258 to 276 (19 residues), see Phobius details amino acids 284 to 305 (22 residues), see Phobius details amino acids 311 to 332 (22 residues), see Phobius details amino acids 353 to 372 (20 residues), see Phobius details amino acids 378 to 400 (23 residues), see Phobius details PF07690: MFS_1" amino acids 29 to 320 (292 residues), 101.4 bits, see alignment E=5.2e-33 amino acids 232 to 402 (171 residues), 38.2 bits, see alignment E=8.3e-14 PF00083: Sugar_tr" amino acids 34 to 410 (377 residues), 82 bits, see alignment E=4.4e-27

Best Hits

Swiss-Prot: 82% identical to YDFJ_ECOLI: Putative transporter YdfJ (ydfJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 90% identity to eae:EAE_18430)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4S5 at UniProt or InterPro

Protein Sequence (430 amino acids)

>BWI76_RS15495 MFS transporter (Klebsiella michiganensis M5al)
MDFQLYSLGAALVFHEIFFPEQSAAMALILAMGTYGAGYIARIVGAFIFGKMGDSIGRKK
VLFITITMMGICTTLIGVLPTYAQVGILAPVLLVTLRIIQGLGAGAEISGAGTMLAEYAP
KGKRGIISSLVAMGTNCGTLSATAIWAVMFFVLDREQLVAWGWRIPFLASAVVMIFAIWL
RLNLKESPVFEQVSEDSGLQNEMATQEGTFSAMLKSKSFWLATGLRFGQAGNSGLLQTFL
AGYLVQTLLFDKAIPTDALMISSVIGFITIPFLGWLSDKVGRRIPYIIVNISAIILAWPM
LSIIVDKSYSASTIMASLIVIHNIAVLGLFALENITMAEMFGSRNRFTRMAISKEAGGLV
AVGFGPVLAGIFCNMTGSWMPIVIMLVCYSIIGLISAILMPEVRDRDLSLLNDAADCAPK
PKSVRSGQYI