Protein Info for BWI76_RS15285 in Klebsiella michiganensis M5al

Annotation: stress protection protein MarC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 transmembrane" amino acids 7 to 32 (26 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 71 to 93 (23 residues), see Phobius details amino acids 118 to 141 (24 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details TIGR00427: membrane protein, MarC family" amino acids 2 to 213 (212 residues), 124.8 bits, see alignment E=1.9e-40 PF01914: MarC" amino acids 6 to 217 (212 residues), 209.9 bits, see alignment E=1.4e-66

Best Hits

Swiss-Prot: 90% identical to MARC_SALPB: UPF0056 inner membrane protein MarC (marC) from Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)

KEGG orthology group: None (inferred from 94% identity to eae:EAE_18555)

Predicted SEED Role

"Multiple antibiotic resistance protein MarC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4C1 at UniProt or InterPro

Protein Sequence (222 amino acids)

>BWI76_RS15285 stress protection protein MarC (Klebsiella michiganensis M5al)
MMDLFKAIGLGLVVILPLANPLTTVALFLGLAGNMNNAERNRQSLMASVYVFAILMVAWY
AGQVVMNTFGISIPGLRIAGGLIVAFIGFRMLFPQQKAHDSMEAKLKSEELEDEPTANIA
FVPLAMPSTAGPGTIAMIISSASTVKHGASFPEWVVLVAPPITFALVGIILWGCLRSSGA
IMRLVGKGGIEAISRLMGFLLVCMGVQFIINGVLEIISTYHA