Protein Info for BWI76_RS15220 in Klebsiella michiganensis M5al

Annotation: L-lactate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00056: Ldh_1_N
  • amino acids 7 to 146 (140 residues), 112.8 bits, E=1.4e-36
• TIGR01771: L-lactate dehydrogenase
  • amino acids 10 to 307 (298 residues), 350.5 bits, E=3.9e-109
• PF02866: Ldh_1_C
  • amino acids 151 to 311 (161 residues), 100.4 bits, E=1.2e-32

Best Hits

Swiss-Prot: 69% identical to LDH2_LISIN: L-lactate dehydrogenase 2 (ldh2) from Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)

KEGG orthology group: K00016, L-lactate dehydrogenase [EC: 1.1.1.27] (inferred from 87% identity to kpe:KPK_2747)

Predicted SEED Role

"L-lactate dehydrogenase (EC 1.1.1.27)" in subsystem Fermentations: Lactate or Fermentations: Mixed acid (EC 1.1.1.27)

MetaCyc Pathways

• hexitol fermentation to lactate, formate, ethanol and acetate (19/19 steps found)
• superpathway of glucose and xylose degradation (17/17 steps found)
• superpathway of anaerobic sucrose degradation (18/19 steps found)
• homolactic fermentation (12/12 steps found)
• heterolactic fermentation (16/18 steps found)
• Bifidobacterium shunt (13/15 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (4/4 steps found)
• pyruvate fermentation to acetate and lactate II (4/4 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (10/13 steps found)
• pyruvate fermentation to (S)-lactate (1/1 steps found)
• methylglyoxal degradation V (2/3 steps found)
• L-histidine degradation V (1/2 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (5/8 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycolysis / Gluconeogenesis
• Propanoate metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.27

Sequence Analysis Tools

See A0A285B487 at UniProt or InterPro

Protein Sequence (314 amino acids)

>BWI76_RS15220 L-lactate dehydrogenase (Klebsiella michiganensis M5al)
MNTKARKVMIIGAGNVGASAAYALLNQSVCEELILVDLNKPRAEAHAQDLSDAAAYMPGM
MTISTREASDCADVDIAVITVSGGALKPGQTRLDELTNTAKIVKSLVPQMMNGGFNGIFL
VATNPCDIITWQVWQLSGLPRGQVLGTGVWLDTTRLRRVLAQALDIGAQSIDAFILGEHG
DAQFPVWSHSAVYGSAIADVYQKHTGKALDRDLIADKVRKLGFEIYAGKGCTEYGVAGTI
AEICRNIFTGSHRALAVSCILDGEYGVTGAAAGVPAVLTQSGVQQIIELQLADDEAEKFR
HAIEVIKASIARLP