Protein Info for BWI76_RS15190 in Klebsiella michiganensis M5al

Annotation: GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 46 to 63 (18 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 125 to 148 (24 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 197 to 221 (25 residues), see Phobius details amino acids 232 to 256 (25 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 305 to 466 (162 residues), 110.5 bits, see alignment E=3.6e-36 PF00990: GGDEF" amino acids 306 to 463 (158 residues), 107.3 bits, see alignment E=3.5e-35

Best Hits

KEGG orthology group: None (inferred from 85% identity to kpn:KPN_01638)

Predicted SEED Role

"FIG00731729: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B448 at UniProt or InterPro

Protein Sequence (470 amino acids)

>BWI76_RS15190 GGDEF domain-containing protein (Klebsiella michiganensis M5al)
MSPLSIRSFTLFREEQPVRDALVLFTLTLLLHFFGAMLRLVQELSFFWPLNAVMAGIFAR
YIWLNRSYFYAICFAAMLVYDGLTSRWGMGLASFLINFSNIVFIVTLAQLILWDKRRADS
MPGPINALSLFCYCLLAALLCAAVGALGSVDVERATFIPQLADWFSEQFSTAVLILPFIL
TLTLPSAFGRFRLRQLLPAIALVLSIVLGVAVGGAGSITFPLPALIWCAIRYPLPLTCLL
TFITGISEILLVANSLIHLTPDTRMQPWQLFSTRLGIAAMLISPIIVASSVEAINNLVKQ
LALRADFDFQTRVYSRSGLSEALKRQPLSEDKRLTVMVLDIDGFKQVNDRWGHECGDCVL
AQFAQQVRLLVGEEGMVARIGGEEFAVAALTSSERDGQVLAEKIRQGIESQTFTWGQYKI
QLTVSMGLESQPLATARVTDLFNQLLMEADDSMIRAKRAGRNRIFTHEMA