Protein Info for BWI76_RS15145 in Klebsiella michiganensis M5al

Annotation: efflux transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF19335: HMBD" amino acids 47 to 73 (27 residues), 44.2 bits, see alignment (E = 6e-15) PF25919: BSH_CusB" amino acids 126 to 242 (117 residues), 77.2 bits, see alignment E=2.8e-25 PF25869: 3HB_CusB" amino acids 162 to 210 (49 residues), 69.1 bits, see alignment 9.4e-23 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 211 to 392 (182 residues), 140 bits, see alignment E=4.4e-45 PF25954: Beta-barrel_RND_2" amino acids 247 to 324 (78 residues), 102.3 bits, see alignment E=5.4e-33 PF25944: Beta-barrel_RND" amino acids 267 to 323 (57 residues), 27.9 bits, see alignment 1e-09 PF25967: RND-MFP_C" amino acids 330 to 387 (58 residues), 32.8 bits, see alignment 2.2e-11 PF25975: CzcB_C" amino acids 332 to 391 (60 residues), 33.2 bits, see alignment E=1.6e-11 PF11604: CusF_Ec" amino acids 413 to 481 (69 residues), 66.5 bits, see alignment E=6.2e-22

Best Hits

KEGG orthology group: K07798, Cu(I)/Ag(I) efflux system membrane protein CusB (inferred from 64% identity to spe:Spro_3363)

Predicted SEED Role

"Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B439 at UniProt or InterPro

Protein Sequence (489 amino acids)

>BWI76_RS15145 efflux transporter periplasmic adaptor subunit (Klebsiella michiganensis M5al)
MKPKSVITLVALAIALAAAGGYWLGSRNAPTLSADGAQTETGRKVLYWYDPMTPGTRFDK
PGKSPFMDMDLVPRYADEGAGEEAGSVQISARQQQNLGVRTADVARRTLAQKLSAFGTVA
IDERSVETVPALASGLIEKLYVNASQQFVKKNEALAELWIPQWAAAQQEYLAVRLLGDSG
LTVAARGRLQLQFMPEAIIRSVERSGKPQTRITVRAPHDGYVSKLDVRTGAQVTATQPLF
ELASLDPVWIVIDYPQSQASLLRVGSQVTAATSSWPGTTFQGTVSELLPDLEATTRTLKA
RVVLNNPQHQLKPGMYLNVELAEAQQGREVLTIPEEALIATGTSNRVLIADGEGYFRPVE
VTAGRTQDGLVEVTSGLEEGQKVVTSGQFLIDSEASLRSALPQMAGQNEEIQSYSAQGVI
KAVSDEAVTIAHQPVPALKWPAMIMDFAITPPLREQVRPGESVMFHFVLTDEGARVTSVM
PMSGAKEQP