Protein Info for BWI76_RS15090 in Klebsiella michiganensis M5al

Annotation: 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 PF00106: adh_short" amino acids 8 to 198 (191 residues), 191.5 bits, see alignment E=1.7e-60 TIGR04316: 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase" amino acids 9 to 259 (251 residues), 301.5 bits, see alignment E=2.5e-94 PF08659: KR" amino acids 10 to 167 (158 residues), 51.4 bits, see alignment E=1.9e-17 PF13561: adh_short_C2" amino acids 13 to 256 (244 residues), 175.1 bits, see alignment E=2.7e-55

Best Hits

Swiss-Prot: 40% identical to VIBA_VIBCH: Vibriobactin-specific 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (vibA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00216, 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase [EC: 1.3.1.28] (inferred from 51% identity to scl:sce3883)

MetaCyc: 40% identical to vibriobactin-specific 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (Vibrio cholerae)
2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase. [EC: 1.3.1.28]

Predicted SEED Role

"2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (EC 1.3.1.28) of siderophore biosynthesis" (EC 1.3.1.28)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.1.28

Use Curated BLAST to search for 1.3.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B483 at UniProt or InterPro

Protein Sequence (261 amino acids)

>BWI76_RS15090 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (Klebsiella michiganensis M5al)
MTFDKDYIAVITGACGGIGESVAHALAKEGVSLALLDNNASQLATLVATLQNNHPQPIAG
FNVDVADDRSVAEAFTAIGRQLGPVGYLVNGAGVLCHASVAETQPQDWTKTFAVNATGVF
NTSRHAANLMMAQRKGSIVTIASNAARVPRATMAAYCASKAAAQAFTYALGLEVAPYGIR
CNVVAPGSTDTPMLRGMWHSESDRQNTLNGNPQQFRIGIPLNKVATAEEIAAAVCFYLCE
ESGQTTLSTLLVDGGAALGSC