Protein Info for BWI76_RS15080 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 transmembrane" amino acids 74 to 91 (18 residues), see Phobius details PF00501: AMP-binding" amino acids 17 to 361 (345 residues), 211.7 bits, see alignment E=1.5e-66 PF13193: AMP-binding_C" amino acids 420 to 492 (73 residues), 24.5 bits, see alignment E=4.3e-09

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4D3 at UniProt or InterPro

Protein Sequence (506 amino acids)

>BWI76_RS15080 hypothetical protein (Klebsiella michiganensis M5al)
MTHSAYVNQLKAVPDIFDEISQRFPDRVALIFDQRQITYRELAEQCSALAAVLQNNCLIK
GDIVAIKIERSPELYIFMLALMKIGAVMVPVNSNSPERYIGEVLSAAGARYLISDDVTSV
PGGSWQVLSSRTLIQNCAQQRSGNYPVLSADDPALILMTSGSTGKPKSVLIAHRGIARLS
LPVPALGNSERDCYLQIADVSFAASANEIWMALLTGACLTIAPPGLPDLMALVRQIESDN
VTMLFLSGGLFRLFVEVSLETLHIPACVVVSGDFVNPRLFSVAAQAGKAKIFNGLGCTEN
SAISSLYHVQSEGQLSSDSPVPVGTALPLVEMVVFNERLQPCACGEYGELFIAGAGVALG
YSDPQLTAERFISIPYQGTDVLFYRTDDRATCDQDSNIVLVGRGNHICKIRGFRVNLAGI
EHLLRLHHAVEDVLIVVEETPDEPRLHACYVTQDDALSVADLKNHLAMHAPAWMIPEKFS
RLAVLPMTANGKKDRLRLKNILLEQV