Protein Info for BWI76_RS15055 in Klebsiella michiganensis M5al

Annotation: lysine transporter LysE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 signal peptide" amino acids 1 to 11 (11 residues), see Phobius details transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 41 to 68 (28 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 146 to 170 (25 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details PF01810: LysE" amino acids 16 to 204 (189 residues), 104.4 bits, see alignment E=2.9e-34

Best Hits

Swiss-Prot: 30% identical to LEUE_KLEP7: Leucine efflux protein (leuE) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 77% identity to kpn:KPN_01740)

Predicted SEED Role

"Putative threonine efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4B4 at UniProt or InterPro

Protein Sequence (206 amino acids)

>BWI76_RS15055 lysine transporter LysE (Klebsiella michiganensis M5al)
MSVADSLLAYSFAALLLTLTPGLDTALILRTSTVEGGKKAFQAALGIDTGCFIWGAVVAF
GLGALLAASALAYDLLKWCGAVYLCWLGIQLILKPRSHFNSQEIAAPSASNWFLKGMLGN
VLNPKMGIFYVSFLPQFIPAGHSPTIWTFLLVAIHVAIGTLWSLTLILASRYAAGLLKTP
TFIRWMDRATGGVFMLFAAKLALSHR