Protein Info for BWI76_RS15050 in Klebsiella michiganensis M5al

Annotation: sugar transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 54 to 71 (18 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 218 to 238 (21 residues), see Phobius details amino acids 250 to 268 (19 residues), see Phobius details amino acids 279 to 297 (19 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details amino acids 334 to 358 (25 residues), see Phobius details amino acids 366 to 386 (21 residues), see Phobius details PF06779: MFS_4" amino acids 23 to 383 (361 residues), 279.4 bits, see alignment E=5.9e-87 PF07690: MFS_1" amino acids 23 to 321 (299 residues), 40.7 bits, see alignment E=1.5e-14

Best Hits

Swiss-Prot: 37% identical to YJIJ_ECOLI: Uncharacterized protein YjiJ (yjiJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 72% identity to eae:EAE_18735)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B420 at UniProt or InterPro

Protein Sequence (395 amino acids)

>BWI76_RS15050 sugar transporter (Klebsiella michiganensis M5al)
MNVFELRPGLKAFLLALAGSAVLMIGMGYGRFAYTGILPLMLNEQVLSLREGNLAASANY
AGYLAGALLLAKARPADARVLNQLSVLLTLLCLTLLGWLVSPLAIIAVRGIAGLLSAVTL
IAASLWLLQHMKHHNGAPVLYSGVGMGIFLSAECISLGKTLALSSQQIWLLCAISAGALF
ILALRLLLSPADYLIAYQSPAGVQDQQAQGRVREAWKLLLVYGLAGFGYIITATYLPLFL
SGSLNAIDPVQIWAIFGLAAVPSCFIWHRLVIRFGYRRAFTLNLLIQAVGVILPAWSHAL
PFCLLSALLVGFTFMGTVTIALPQGRRLNHLVSFNMIAAMTATYGVGQIVGPLVAGALYE
RSGSFNPSLSAAAGALVVAAALVAAGGRRASKVGG