Protein Info for BWI76_RS15035 in Klebsiella michiganensis M5al

Annotation: metal ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 transmembrane" amino acids 22 to 45 (24 residues), see Phobius details amino acids 57 to 81 (25 residues), see Phobius details amino acids 87 to 110 (24 residues), see Phobius details amino acids 122 to 140 (19 residues), see Phobius details amino acids 151 to 177 (27 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 51 to 217 (167 residues), 65.8 bits, see alignment E=2.1e-22

Best Hits

Swiss-Prot: 52% identical to METI_VIBCH: Probable D-methionine transport system permease protein MetI (metI) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02072, D-methionine transport system permease protein (inferred from 93% identity to kpu:KP1_2697)

MetaCyc: 45% identical to L-methionine/D-methionine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
RXN0-4522 [EC: 7.4.2.11]; 7.4.2.11 [EC: 7.4.2.11]; TRANS-RXN-383 [EC: 7.4.2.11]; TRANS-RXN0-510 [EC: 7.4.2.11]; TRANS-RXN0-511 [EC: 7.4.2.11]

Predicted SEED Role

"Methionine ABC transporter permease protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4C4 at UniProt or InterPro

Protein Sequence (223 amino acids)

>BWI76_RS15035 metal ABC transporter permease (Klebsiella michiganensis M5al)
MRSSMSWEDLWPLLLQGTVDTVYIVGLAALFTVLLGLPTGVLLFVSRRNGLAPMPKLNAV
LGAIINFGRSLPFIVLLIALIPFTRLIIGTTLGSTAAVVPVTIGAFPFFARLTENALDEV
DYGRIEAILSMGGNIWHVIFKSLLPEALPTLLAGITLTIVMLIGFSSMAGVIGGGGLGDL
AIRYGYQRFNNEVMVGTVLILVALVQGVQMAGDRLVRGLAHRR