Protein Info for BWI76_RS15025 in Klebsiella michiganensis M5al

Annotation: NLPA lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF03180: Lipoprotein_9" amino acids 27 to 264 (238 residues), 266.1 bits, see alignment E=1.1e-83

Best Hits

Swiss-Prot: 40% identical to PLPB_MANHA: Outer membrane lipoprotein 2 (plpB) from Mannheimia haemolytica

KEGG orthology group: None (inferred from 96% identity to eae:EAE_18760)

Predicted SEED Role

"Methionine ABC transporter substrate-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation or Staphylococcal pathogenicity islands SaPI

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4D8 at UniProt or InterPro

Protein Sequence (268 amino acids)

>BWI76_RS15025 NLPA lipoprotein (Klebsiella michiganensis M5al)
MKYAAFKLAGVALSLSLAWTSAQAAALRVAADPVPHAEILNYIKKIDPSLDLKIVELTSG
VNANELLANGDVDANYFQHVPYLKDQEKALGKTFAVAATVHIEPLGIYSRKHKDFKSLPE
NATVAVPNNTTNLSRALFLLQNQGLIKLAAKFTDPATTLATPKDIVENPKHLKILEIESP
QIPRSLDDVDLAVINGNYALEAGLVPAKDALGLESATNNPYANILVTTPALANDPRIKAL
AKDLTSPQVAEFIRKQYNGSVIPVAPQS