Protein Info for BWI76_RS15020 in Klebsiella michiganensis M5al

Annotation: 2-oxobutyrate oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 PF14226: DIOX_N" amino acids 6 to 128 (123 residues), 130 bits, see alignment E=7.2e-42 PF03171: 2OG-FeII_Oxy" amino acids 177 to 274 (98 residues), 80.9 bits, see alignment E=7.6e-27

Best Hits

KEGG orthology group: K06892, (no description) (inferred from 90% identity to kva:Kvar_2674)

Predicted SEED Role

"2-Oxobutyrate oxidase, putative" in subsystem Methionine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B494 at UniProt or InterPro

Protein Sequence (342 amino acids)

>BWI76_RS15020 2-oxobutyrate oxidase (Klebsiella michiganensis M5al)
MNATTLPILDLARYADPAEKAAFLADLRHAARDIGFFYLINHGVDESLQQAVQEQSRAFF
ALPDAQKQSVAMIHSPHFRGYNRAASELTRGQPDWREQFDIGAERPALRLDERAPRWQRL
QGPNLWPEALPSLRPTLLTWQREMTQVGITLLRAFAEALHLPLDAFDGLYGEKPNEHIKL
IRYPGQQETQSAQGVGAHKDSGFLSFLLQDEQKGLQVEVSPDRWIDATPLAGSFVVNIGE
LLELATNGYLRATVHRVVSPPADQQRLSIAFFLGAQLDAVVPVYTLPDELAREALGPDSD
PQNPLLREVGWNYLKGRLRSHPDVAERYYQDVFRERAEQLIV