Protein Info for BWI76_RS14990 in Klebsiella michiganensis M5al

Annotation: polar amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 transmembrane" amino acids 19 to 44 (26 residues), see Phobius details amino acids 56 to 81 (26 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 175 to 178 (4 residues), see Phobius details amino acids 196 to 219 (24 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 11 to 121 (111 residues), 52.3 bits, see alignment E=3.3e-18 PF00528: BPD_transp_1" amino acids 49 to 217 (169 residues), 55.5 bits, see alignment E=3.1e-19

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 90% identity to kpe:KPK_1531)

Predicted SEED Role

"FIG00732649: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B412 at UniProt or InterPro

Protein Sequence (250 amino acids)

>BWI76_RS14990 polar amino acid ABC transporter permease (Klebsiella michiganensis M5al)
MFSLTFIRDNFTFILSALPVTLAITLLSLLFSTLLGAALAWAIIRQIPGVQVAAKVFLSF
GRSVPVLVMLYFFFYVWPWVAVGLFGGPQDTMFGYKLSPQAAAVTALSLIFSAYFAETFR
AGWNAVDKGQREAAWSIGLSGFTQFRRIILPQAAVSALPNFTSVLIDLIKDTSLVYTITV
VDLMAKANIAAARGFHFVEAYCVVLVIYILLCLAIARALRSAETFLSARWQGNGQKSGPR
LSFWGKYFEK