Protein Info for BWI76_RS14970 in Klebsiella michiganensis M5al

Annotation: pyrroline-5-carboxylate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF03807: F420_oxidored" amino acids 3 to 94 (92 residues), 22.2 bits, see alignment E=1.8e-08 PF14748: P5CR_dimer" amino acids 155 to 259 (105 residues), 91.6 bits, see alignment E=3.7e-30

Best Hits

KEGG orthology group: K00286, pyrroline-5-carboxylate reductase [EC: 1.5.1.2] (inferred from 93% identity to kpe:KPK_1534)

Predicted SEED Role

"Pyrroline-5-carboxylate reductase (EC 1.5.1.2)" in subsystem Proline Synthesis (EC 1.5.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.5.1.2

Use Curated BLAST to search for 1.5.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B488 at UniProt or InterPro

Protein Sequence (262 amino acids)

>BWI76_RS14970 pyrroline-5-carboxylate reductase (Klebsiella michiganensis M5al)
MAKIHFIGAGQMAEAIIRASLSNGALRADAISLEDIDSARAEHLYAHYRLSGDGGVNEAS
LLVLGIRPQDDLAGVANRVRAQLNGLTTVVSLIAGVTLEKLASLFGEATPIARAIPNTLT
DTGFGYSGVTLNAHASAAEIEPFLRGFGKVLYLPERLIDIFTGFAVAGPNYIYYFIESFT
DAGVLAGLSRPQATEVVLENLLGAVEMLRQSQKHPRQLLDINNSPAGVGIHGLYELNNSD
FAAGLQRSVLAAVRRTRELGQR