Protein Info for BWI76_RS14930 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 PF00005: ABC_tran" amino acids 32 to 179 (148 residues), 108.3 bits, see alignment E=5e-35 PF13304: AAA_21" amino acids 142 to 210 (69 residues), 28.4 bits, see alignment E=1.6e-10

Best Hits

Swiss-Prot: 39% identical to HMUV_PSEPK: Hemin import ATP-binding protein HmuV (hmuV) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K02013, iron complex transport system ATP-binding protein [EC: 3.6.3.34] (inferred from 79% identity to cko:CKO_00850)

MetaCyc: 37% identical to ferric enterobactin ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-10-RXN [EC: 7.2.2.17]

Predicted SEED Role

"ABC transporter (iron.B12.siderophore.hemin) , ATP-binding component"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.34

Use Curated BLAST to search for 3.6.3.34 or 7.2.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B435 at UniProt or InterPro

Protein Sequence (269 amino acids)

>BWI76_RS14930 hypothetical protein (Klebsiella michiganensis M5al)
MEESLTKGGTTNVPVLSVSIASLPRPGGGDILADIHFSAGKGECLAVIGPNGSGKTSLLR
AIDHELTVREGDVRLYGRSVSALTRQQRARQIAVLAQNDAPDMRLALEDYVALGRIPHAR
DMSRREHESIVTRAINDTGLQKLRTRSLSALSGGERQRAALARVLAQSPKLVLLDEPTNH
LDPQARVELLALVKSLGITVVAVLHDLSLIESFADRVLLLSQGRALAWDVPERVLVSERL
YPVFGLTSFTVPHPETGKALRIFEVPGYA