Protein Info for BWI76_RS14905 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 38 to 58 (21 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 121 to 137 (17 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 178 to 196 (19 residues), see Phobius details amino acids 217 to 241 (25 residues), see Phobius details amino acids 243 to 272 (30 residues), see Phobius details amino acids 296 to 321 (26 residues), see Phobius details amino acids 327 to 346 (20 residues), see Phobius details amino acids 352 to 370 (19 residues), see Phobius details PF03611: EIIC-GAT" amino acids 7 to 381 (375 residues), 245.1 bits, see alignment E=7.1e-77

Best Hits

KEGG orthology group: K02775, PTS system, galactitol-specific IIC component (inferred from 96% identity to kpe:KPK_4470)

Predicted SEED Role

"PTS system, galactitol-specific IIC component (EC 2.7.1.69)" in subsystem D-Tagatose and Galactitol Utilization (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B486 at UniProt or InterPro

Protein Sequence (420 amino acids)

>BWI76_RS14905 hypothetical protein (Klebsiella michiganensis M5al)
MDIINSIISLGASVMMPVIFFIIALCFGVKVGTAFKAGMLVGIGFEGVGLVIGLLLTNLG
PASQAMVERIGLHLTVVDTGWPTASTIGWGSPLMLPVVVGFIVINIAMLLLKLTKTVNID
IFNYWIFLIMGSVVYAGTGNYWLSVGITFGIFILTLLAADLTAPYLQKNYNLQGISFPHL
TCITYVPFGIACNYIIDKIPLINKINFDPESINKKFGVFGEPLTLGFVLGLLLAFLAGYD
VSAAVSLAIKVSAAMLLLPKMIEILVQGLLIVRDAAEAKLKAKFPDRDFYIGMDTALLIG
EPSVLATGLLLIPMAVVLAIILPGNRVLPFVDLASLMFLLAMVTPFCKRNMFRMFITGTL
VVSCILYVGTDISHEYTQAAVNSHIPVPEGMSEITNIVGGATTPVGWLALKFGEFFSTAP