Protein Info for BWI76_RS14885 in Klebsiella michiganensis M5al

Annotation: putative glycerol uptake operon antiterminator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 PF04309: G3P_antiterm" amino acids 7 to 183 (177 residues), 165.3 bits, see alignment E=4.6e-53

Best Hits

KEGG orthology group: K02443, glycerol uptake operon antiterminator (inferred from 94% identity to ecy:ECSE_0275)

Predicted SEED Role

"Glycerol uptake operon antiterminator regulatory protein" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B497 at UniProt or InterPro

Protein Sequence (183 amino acids)

>BWI76_RS14885 putative glycerol uptake operon antiterminator (Klebsiella michiganensis M5al)
MHLNNTIIPSVRKYKHFEQALSCSSEYVLLSEANIGNLQSLIGKCHQSGKKVLIHLELLG
GFKPDQAGISLLKNYYKVDGVISSNLSALRHAKKEGLLTIFRVLLIDSRSLDQSIDIVKH
NPPDAIEILPAEYACQCLELISRNLKGFDVIFIAGGFVKRKYLVDKIFHAGFKGITSSEP
GLW