Protein Info for BWI76_RS14880 in Klebsiella michiganensis M5al

Annotation: putative fructose-bisphosphate aldolase, class 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF01791: DeoC" amino acids 45 to 232 (188 residues), 74.2 bits, see alignment E=6.2e-25

Best Hits

KEGG orthology group: K01623, fructose-bisphosphate aldolase, class I [EC: 4.1.2.13] (inferred from 92% identity to kpu:KP1_1114)

Predicted SEED Role

"2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase (EC 2.5.1.-)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.5.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-, 4.1.2.13

Use Curated BLAST to search for 2.5.1.- or 4.1.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B427 at UniProt or InterPro

Protein Sequence (262 amino acids)

>BWI76_RS14880 putative fructose-bisphosphate aldolase, class 1 (Klebsiella michiganensis M5al)
MSKERRLSRIFAKDGKSVTLALDGYYFSSNTNGIDNTIKQLPVLVENGLDCALVTWGMLK
NFREIFNSVPVVLRVDSTVSIFDNTVPDTTPVFSIEDALKVAADGVVCMTFPGAFNEEKT
HIMAMQLAQAADRWSMPLIVESLPYGYPVTSDDSNNPAIIAASARVAVELGADVIKTRFT
GTEDDRLIVEAAGVPVLALGGPKTGIDGYFKFVHHCMQVGAKGVAVGRNITQDPRPEKVV
AGLNAIIHENATAEDAYSLYMV