Protein Info for BWI76_RS14865 in Klebsiella michiganensis M5al

Annotation: ribose ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 25 to 43 (19 residues), see Phobius details amino acids 55 to 77 (23 residues), see Phobius details amino acids 81 to 145 (65 residues), see Phobius details amino acids 169 to 191 (23 residues), see Phobius details amino acids 220 to 244 (25 residues), see Phobius details amino acids 252 to 270 (19 residues), see Phobius details amino acids 277 to 298 (22 residues), see Phobius details amino acids 304 to 321 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 50 to 315 (266 residues), 164 bits, see alignment E=2.1e-52

Best Hits

Swiss-Prot: 49% identical to RBSC_BACSU: Ribose import permease protein RbsC (rbsC) from Bacillus subtilis (strain 168)

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 78% identity to ach:Achl_4607)

MetaCyc: 52% identical to ribose ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-28-RXN

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4D9 at UniProt or InterPro

Protein Sequence (339 amino acids)

>BWI76_RS14865 ribose ABC transporter permease (Klebsiella michiganensis M5al)
MDNNKPVTELPVKAPFDFAKWWDRVGILIVLLVLLILMSTFAPNFNRVDNLLNIARSISV
NAILAAGMTFVILTSGIDLSVGSIVAVSGVVSVVAAMAGIPAPLAILAGVGVGALCGLLN
GVLTAYLALAPFIVTLGTMTFLRGMAYTITEGQPIVSSSLSFRELGNGYLIGIPIPVIIM
LVVYLLAWFILERTRFGRHIYAVGGNAQAARLAGVRVKRVLAAVYMIAGVCAGLAGIIFA
ARVISAQPTAGTGYELDAIAAVVLGGTSLAGGRGRIIGTLIGSIILGVLSTGLILLSVPF
FTQLLIKGIVIILAVAIDGLKQHPELFTFWRKKEIARPR