Protein Info for BWI76_RS14855 in Klebsiella michiganensis M5al

Annotation: periplasmic binding protein/LacI transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF00532: Peripla_BP_1" amino acids 39 to 246 (208 residues), 70.9 bits, see alignment E=1.9e-23 PF13407: Peripla_BP_4" amino acids 40 to 292 (253 residues), 204.8 bits, see alignment E=2.7e-64 PF13377: Peripla_BP_3" amino acids 200 to 309 (110 residues), 36.5 bits, see alignment E=8.1e-13

Best Hits

KEGG orthology group: K10439, ribose transport system substrate-binding protein (inferred from 70% identity to ach:Achl_4609)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3Y7 at UniProt or InterPro

Protein Sequence (317 amino acids)

>BWI76_RS14855 periplasmic binding protein/LacI transcriptional regulator (Klebsiella michiganensis M5al)
MTKLRKAWLAIAVAAVITTMTGLAPAASAAPQESKKIARIGLMVQDMSNPFFSAMERNAK
QAAAKIGATLNVQDAQVDLANQNTQIDAFIQQKVDLIIISAVDESGIEPAIQRAKAAGII
VIAVDTPAKGADAAIMTNAIQAGETSCEYLFSQMGGKGKVLLVDGTPIQTIIDRIKGCKN
VAQKYPDIKIVGQQASRNDRASGLMVTTDMLTANPDVSGIFGMNDPSALGAVLAVEQAGK
AGAINVTGVDGSPEAVEELKRGGSPFIGTATQNPGEMVRQAISLAQDMVDGKPIASRTVL
IPSVLVTRDNVGSYPGW