Protein Info for BWI76_RS14810 in Klebsiella michiganensis M5al

Annotation: carboxymuconolactone decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF02627: CMD" amino acids 46 to 130 (85 residues), 69.8 bits, see alignment E=8.2e-24 amino acids 173 to 256 (84 residues), 73.5 bits, see alignment E=5.7e-25

Best Hits

KEGG orthology group: None (inferred from 77% identity to srr:SerAS9_3889)

Predicted SEED Role

"4-carboxymuconolactone decarboxylase (EC 4.1.1.44)" in subsystem Protocatechuate branch of beta-ketoadipate pathway (EC 4.1.1.44)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.44

Use Curated BLAST to search for 4.1.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3Y0 at UniProt or InterPro

Protein Sequence (266 amino acids)

>BWI76_RS14810 carboxymuconolactone decarboxylase (Klebsiella michiganensis M5al)
MKAFITAAAMSLMLGAPVLAEEKRGEKMAPFSPTQLSVEDVQSVAPALARFGSEVLTEDL
WARNELSRRDRSIVTVAILIARHQPAELKHYVDVALDNGVTAAEISEIVTHLAFYSGWPN
AMSAVAVTKDIFIARGIGREQLASASPELLPLNQEMEKQRSTTVEQNVGAISPGLVKFTT
QPLFLDLWQRPGLKPRDRSLVTVSALIAAGQSAQIGYHLNRAMDNGLTAEEAGEVVAHAA
FYAGWPNAFSAVAVVSEVLRARGLAG