Protein Info for BWI76_RS14735 in Klebsiella michiganensis M5al

Annotation: type 11 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 PF13489: Methyltransf_23" amino acids 32 to 151 (120 residues), 33.8 bits, see alignment E=1.1e-11 PF05175: MTS" amino acids 44 to 150 (107 residues), 29.3 bits, see alignment E=2.5e-10 PF01209: Ubie_methyltran" amino acids 45 to 151 (107 residues), 21.2 bits, see alignment E=6.7e-08 PF02353: CMAS" amino acids 46 to 204 (159 residues), 35.9 bits, see alignment E=2.1e-12 PF13847: Methyltransf_31" amino acids 47 to 163 (117 residues), 59.4 bits, see alignment E=1.5e-19 PF13649: Methyltransf_25" amino acids 51 to 147 (97 residues), 68.6 bits, see alignment E=2.5e-22 PF08242: Methyltransf_12" amino acids 52 to 149 (98 residues), 48 bits, see alignment E=6.9e-16 PF08241: Methyltransf_11" amino acids 52 to 151 (100 residues), 65.7 bits, see alignment E=1.9e-21

Best Hits

KEGG orthology group: None (inferred from 74% identity to pao:Pat9b_4631)

Predicted SEED Role

"Methyltransferase type 11"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (222 amino acids)

>BWI76_RS14735 type 11 methyltransferase (Klebsiella michiganensis M5al)
MNPYEKMYRQLLENGAIAWAGEGYLRAKKQQERVFSWLDLQQYFPQPGAPVLELGCGNGA
MAAQYFAERGYSVWGMDLSATAIRWAENRFQQAGLAAQFFVGDVCHIHQCQDATFELIID
GSCTHCLIDEARHLCFAEVRRLLRPGGRFVVGSMCGTPRHPEDVAAYDPIRHHLFKEGQP
WRTLRPLQALLDEIRDEHFDVLEVNVNENPWWDHATVVCCVK