Protein Info for BWI76_RS14695 in Klebsiella michiganensis M5al

Annotation: fimbrial biogenesis outer membrane usher protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 833 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF13954: PapC_N" amino acids 33 to 178 (146 residues), 122.4 bits, see alignment E=2.3e-39 PF00577: Usher" amino acids 196 to 746 (551 residues), 499 bits, see alignment E=3.2e-153 PF13953: PapC_C" amino acids 758 to 812 (55 residues), 52.5 bits, see alignment 5.4e-18

Best Hits

Swiss-Prot: 52% identical to PAPC_ECOLX: Outer membrane usher protein PapC (papC) from Escherichia coli

KEGG orthology group: None (inferred from 61% identity to pam:PANA_2724)

Predicted SEED Role

"Fimbriae usher protein StfC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (833 amino acids)

>BWI76_RS14695 fimbrial biogenesis outer membrane usher protein (Klebsiella michiganensis M5al)
MKKSRPPAYYLRRLGIYIAIAIFGSTSPVVAVEFNVDILDSEDRENIDLSRFSRAGYIMP
GTYTLSMRLNDRGISDQDITFVERIREDQLVVEACLTPEQVDLLGLREDALKMIQWLDGG
RCADFSALEGIVLRGDLAESSLQVAMPQAWLEYQDASWLPVSRWEEGIPGLLFDYNLNTN
VTFPRRGNQSQSASVSGTTGVNLGPWRLRGDYQGSYYNTTGRPNSTNCDFDWSRFYAYRA
LPGIMSKLTVGEDYLTSDLFDSWRYTGLSLVSDESQLPPKLRGYAPEVSGIARTNAKVTV
TQQGRVIYESTVAAGPFRIQELSSALTGRLDVRVEEQDGSVQTFAVDTAQVPYLTRPGQL
RYKLTTGRPRDYRHSTQGPYFATGELSWGLTNAWSVYGGGIFSQDYNSVALGAGRDMSVY
GTLSADVTHASARFPGDKNRHGRSWRLSYSKRFDELSSEVTFAGYRFSERNYLTMGEYLD
IRYREGYIGNSKELYTLQATKNFEDLRLSTSINWSHQTYWNRPATDRYSVSLNKYFDLGD
WRHLSLSLNAARSEFNGRKDDTAYISLTMPFGSGTVGYNGSINRDRYTQNASWSDRLENN
DYYRINAGNSIGGGQGTRSQMSGYYSHPGSMADVTTNFNWAQSQYTSFGISASGGMTATA
EGVALHSGGVQGGTRLMVSTDGVSGVPVGYQSYTNAFGIAVIPGVPNYFRTSAEIDVNRL
PDDVETSGSPIAELALTEGAIGFRRFDVLKGAKVVAILSQEDGRHPPFGATVHNAKEREL
GMVSDGGLAWLTGVNPDEHLTVHWGGSARCEVVLPRVLPAQQLLLPCKPISRG