Protein Info for BWI76_RS14675 in Klebsiella michiganensis M5al

Annotation: fimbrial chaperone YfcS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00345: PapD_N" amino acids 25 to 142 (118 residues), 126.9 bits, see alignment E=4.6e-41 PF02753: PapD_C" amino acids 168 to 227 (60 residues), 42.7 bits, see alignment E=5.5e-15

Best Hits

KEGG orthology group: None (inferred from 56% identity to pam:PANA_2717)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B440 at UniProt or InterPro

Protein Sequence (250 amino acids)

>BWI76_RS14675 fimbrial chaperone YfcS (Klebsiella michiganensis M5al)
MKKTLVFATVAVLSASSLLPAEAALTVSRSRVIVNEGDKSVSMSVTNRNTQEPYLAQTWI
EDETEAKVTSPLMVLPPVQRIEAGSKSAVRVQVLPDIGKLPKDRESVFWFNLREIPPRSD
KPNVLTLALQTRLKIFWRPASIKVDAKYDSFPGIQNVTLAKNGNRYTLNNPTPYHLTFVE
GRSSVKGKGKEGFEPIMVAPKAQTALNVGAADLGATPVLVFVNDYGSLRLLPFQCTGSAC
KAQPVITPES