Protein Info for BWI76_RS14645 in Klebsiella michiganensis M5al

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 585 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 297 to 320 (24 residues), see Phobius details PF12974: Phosphonate-bd" amino acids 26 to 253 (228 residues), 103.2 bits, see alignment E=2.4e-33 PF02518: HATPase_c" amino acids 468 to 566 (99 residues), 54.7 bits, see alignment E=2e-18

Best Hits

Swiss-Prot: 67% identical to TTRS_SALTY: Tetrathionate sensor histidine kinase TtrS (ttrS) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K13040, two-component system, LuxR family, sensor histidine kinase TtrS [EC: 2.7.13.3] (inferred from 67% identity to stt:t1254)

Predicted SEED Role

"Tetrathionate reductase sensory transduction histidine kinase" in subsystem Tetrathionate respiration

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3V0 at UniProt or InterPro

Protein Sequence (585 amino acids)

>BWI76_RS14645 sensor histidine kinase (Klebsiella michiganensis M5al)
MGRLALLISTLLLICPARADSWYIGLLSIRGDAIARSSWQPLESFLNQQMPDQQFHIRPL
DLHEMQEAVKNGSVQFVVTHPGQFVQLNTHFPLRWLASLRASHGVKNIIGSVILARRDGE
IKTPMDLIGKTVGAIDPLAFGGYLLGYKALSDAGLRPDSDLHLRFTGFPADALIYLLREN
AVQAAIVPACLLEMMDEEGLIDKVDFVALITRPESAPCVTSTRLYRDWSFAALPTVSDEV
ADRVTRVLLNAPDNAVFRWGAPASTSQAEALMRELKQHPQQRLLWMDVRNWFVQNRLLVA
GAGLILILLILNYIWVMLLVRRRGRQLERSAIRLREQEQALETARQISVLGEMTSGFAHE
LNQPLSAIRHYAQGCSIRLQKQDPQHPLLSALENIDLQAQRGAETLRNLRLWVSQAQGES
VTAEKWESVRIVQAIDNVWQWLHVPRQFPGLRMISNIDHALTIVLPPVLLEQVLANLILN
AAQAGAKMLWIDAVRDAGSVRIVLQDNAGGIDDAQLAQAFQPFKSSRQEGMGLGLVICQR
LVRYGRGEIGIRNQTAPDGRPGAVVVLAFTHQEERSDNGDNSSLR