Protein Info for BWI76_RS14640 in Klebsiella michiganensis M5al

Annotation: DNA-binding response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 PF00072: Response_reg" amino acids 4 to 113 (110 residues), 85.1 bits, see alignment E=5.7e-28 PF08281: Sigma70_r4_2" amino acids 129 to 178 (50 residues), 28.7 bits, see alignment E=1.3e-10 PF00196: GerE" amino acids 135 to 188 (54 residues), 61 bits, see alignment E=1e-20

Best Hits

Swiss-Prot: 79% identical to TTRR_SALTY: Tetrathionate response regulatory protein TtrR (ttrR) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K13041, two-component system, LuxR family, response regulator TtrR (inferred from 79% identity to sew:SeSA_A1484)

Predicted SEED Role

"Tetrathionate reductase two-component response regulator" in subsystem Tetrathionate respiration

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B481 at UniProt or InterPro

Protein Sequence (195 amino acids)

>BWI76_RS14640 DNA-binding response regulator (Klebsiella michiganensis M5al)
MAIIHLLDDDPAVTRACAFLLESLGYEAVCWEEGERFLAQADLYQVGVVLLDMRMPVLDG
QAVHEALRQRGSTLAVVFLTGHGDVPMAVEEMKRGAVDFLQKPVSLKPLQAALEHGLTVS
GERFAQKKVVDCYQQLTPKERELALLVMKGLMNREIAQAMSIAVRTVEVHRARVMEKMQA
GSLAELVSKLQRVTR